PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun006872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family S1Fa-like
Protein Properties Length: 83aa    MW: 9165.84 Da    PI: 10.6282
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-31123PU_refplantGDBView CDS
gnl|UG|Vun#S45869514PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA136.27.9e-431983670
       S1FA  6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
               +  +G+nPGlivllvvgglll+flvgn++ly+yaqk+lPPrkkkPvskkk+k+e+lkqGv++PGe
  Vun006872 19 ASNQGFNPGLIVLLVVGGLLLTFLVGNFVLYTYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE 83
               5569************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046892.9E-402083IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MADDFEFADK VPPSFDRVAS NQGFNPGLIV LLVVGGLLLT FLVGNFVLYT YAQKTLPPRK  60
KKPVSKKKMK KERLKQGVSA PGE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162731.11e-53hypothetical protein PHAVU_001G175700g
SwissprotQ7XLX61e-15S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLV7CZP41e-53V7CZP4_PHAVU; Uncharacterized protein
STRINGPOPTR_0016s08890.12e-26(Populus trichocarpa)